DCAMKL1 (DCLK1) (NM_001195416) Human Recombinant Protein

DCAMKL1 (DCLK1) (NM_001195416) Human Recombinant Protein

DCAMKL1 (DCLK1) (NM_001195416) Human Recombinant Protein

Product Information

Product Name DCAMKL1 (DCLK1) (NM_001195416) Human Recombinant Protein
Cat.No RP75271
Description Purified recombinant protein of Homo sapiens doublecortin-like kinase 1 (DCLK1), transcript variant 3.
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence Protein Sequence (showhide)


>RC231229 representing NM_001195416
Red=Cloning site Green=Tags(s)
MLELIEVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRSSQHGGSSTSLASTKVCSSMDENDGPGEEVSE
EGFQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPN
IVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENL
LVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPF
RGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEH
QLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNSESEDYSP
SSSETVRSPNSPF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48.1
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Bioactivity ELISA standard (PMID: 29577277)
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
RefSeq NP_001182345
Locus ID 9201
UniProt ID O15075,


B7Z5K4,


O15075-4
Cytogenetics 13q13.3
Refseq ORF 1299
Synonyms CL1; CLICK1; DCAMKL1; DCDC3A; DCLK
Summary This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. The encoded protein is involved in several different cellular processes, including neuronal migration, retrograde transport, neuronal apoptosis and neurogenesis. This gene is up-regulated by brain-derived neurotrophic factor and associated with memory and general cognitive abilities. Multiple transcript variants generated by two alternative promoter usage and alternative splicing have been reported, but the full-length nature and biological validity of some variants have not been defined. These variants encode different isoforms, which are differentially expressed and have different kinase activities.[provided by RefSeq, Sep 2010]
Protein Families Druggable Genome, Protein Kinase